SCOPe 2.05: Domain d2kuca_: 2kuc A:

Lineage for d2kuca_ (2kuc A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (147 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:818] [232191] (2 PDB entries)

8. Domain d2kuca_: 2kuc A: [242667]
   automated match to d3tcoa_

Details for d2kuca_

PDB Entry: 2kuc

PDB Description: solution structure of a putative disulphide-isomerase from bacteroides thetaiotaomicron

PDB Compounds: (A:) Putative disulphide-isomerase

SCOPe Domain Sequences for d2kuca_:

Sequence; same for both SEQRES and ATOM records:

>d2kuca_ c.47.1.0 (A:) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
aqadgiafrelsfpealkraevedkllfvdcfttwcgpckrlskvvfkdslvadyfnrhf
vnlkmdmekgegvelrkkygvhayptllfinssgevvyrlvgaedapellkkvklgvese
g

Timeline for d2kuca_:

• d2kuca_ first appeared in SCOPe 2.04
  
• d2kuca_ is called d2kuca1 in SCOPe 2.06
  
• d2kuca_ appears in the current release, SCOPe 2.08, called d2kuca1