SCOPe 2.08: Domain d2kuca1: 2kuc A:1-119

Lineage for d2kuca1 (2kuc A:1-119)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Bacteroides thetaiotaomicron [TaxId:818] [232191] (2 PDB entries)

8. Domain d2kuca1: 2kuc A:1-119 [242667]
   Other proteins in same PDB: d2kuca2
   automated match to d3tcoa_

Details for d2kuca1

PDB Entry: 2kuc

PDB Description: solution structure of a putative disulphide-isomerase from bacteroides thetaiotaomicron

PDB Compounds: (A:) Putative disulphide-isomerase

SCOPe Domain Sequences for d2kuca1:

Sequence; same for both SEQRES and ATOM records:

>d2kuca1 c.47.1.0 (A:1-119) automated matches {Bacteroides thetaiotaomicron [TaxId: 818]}
aqadgiafrelsfpealkraevedkllfvdcfttwcgpckrlskvvfkdslvadyfnrhf
vnlkmdmekgegvelrkkygvhayptllfinssgevvyrlvgaedapellkkvklgves

Timeline for d2kuca1:

• d2kuca1 first appeared in SCOPe 2.04, called d2kuca_
  
• d2kuca1 appears in SCOPe 2.07