SCOPe 2.08: Domain d2ku6a1: 2ku6 A:121-232

Lineage for d2ku6a1 (2ku6 A:121-232)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 proteins)

6. Protein automated matches [191016] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [234629] (15 PDB entries)

8. Domain d2ku6a1: 2ku6 A:121-232 [242666]
   Other proteins in same PDB: d2ku6a2
   automated match to d1xyxa_
   mutant

Details for d2ku6a1

PDB Entry: 2ku6

PDB Description: mouse prion protein (121-231) with mutations d167s and n173k

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d2ku6a1:

Sequence; same for both SEQRES and ATOM records:

>d2ku6a1 d.6.1.1 (A:121-232) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vvgglggymlgsamsrpmihfgndwedryyrenmyrypnqvyyrpvsqysnqknfvhdcv
nitikqhtvttttkgenftetdvkmmervveqmcvtqyqkesqayydgrrss

Timeline for d2ku6a1:

• d2ku6a1 first appeared in SCOPe 2.04, called d2ku6a_
  
• d2ku6a1 appears in SCOPe 2.07