Lineage for d2ku2d_ (2ku2 D:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1934404Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1934405Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1934574Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1936395Protein automated matches [190144] (7 species)
    not a true protein
  7. 1937257Species Thermoplasma acidophilum [TaxId:2303] [186869] (7 PDB entries)
  8. 1937324Domain d2ku2d_: 2ku2 D: [242660]
    automated match to d1yaua_

Details for d2ku2d_

PDB Entry: 2ku2 (more details)

PDB Description: dynamic regulation of archaeal proteasome gate opening as studied by trosy-nmr
PDB Compounds: (D:) Proteasome subunit alpha

SCOPe Domain Sequences for d2ku2d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ku2d_ d.153.1.4 (D:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
gamgmqqgqmaggraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrs
rlieqnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrv
adqmqqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsfl
ereykenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOPe Domain Coordinates for d2ku2d_:

Click to download the PDB-style file with coordinates for d2ku2d_.
(The format of our PDB-style files is described here.)

Timeline for d2ku2d_: