Lineage for d1af9_1 (1af9 875-1110)
- Root: SCOP 1.57
Class b: All beta proteins [48724] (104 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) 
Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (2 proteins) Protein Tetanus neurotoxin [49957] (1 species) Species Clostridium tetani [49958] (8 PDB entries) 
Domain d1af9_1: 1af9 875-1110 [24266]
Other proteins in same PDB: d1af9_2
Details for d1af9_1
PDB Entry: 1af9 (more details), 2.7 Å
PDB Description: tetanus neurotoxin c fragment
SCOP Domain Sequences for d1af9_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1af9_1 b.29.1.6 (875-1110) Tetanus neurotoxin {Clostridium tetani}
edidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkaihlvnnessevi
vhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkhslsigsgwsvs
lkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlssanlyingvlmg
saeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeieklytsyls
SCOP Domain Coordinates for d1af9_1:
Click to download the PDB-style file with coordinates for d1af9_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1af9_1:
- d1af9_1 first appeared (with stable ids) in SCOP 1.55
- d1af9_1 appears in SCOP 1.59
- d1af9_1 appears in the current release, SCOPe 2.08, called d1af9a1
View in 3D
