SCOPe 2.05: Domain d2ku1a_: 2ku1 A:

Lineage for d2ku1a_ (2ku1 A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein automated matches [190144] (7 species)
   not a true protein

7. Species Thermoplasma acidophilum [TaxId:2303] [186869] (7 PDB entries)

8. Domain d2ku1a_: 2ku1 A: [242650]
   automated match to d1ya7a_

Details for d2ku1a_

PDB Entry: 2ku1

PDB Description: dynamic regulation of archaeal proteasome gate opening as studied by trosy-nmr

PDB Compounds: (A:) Proteasome subunit alpha

SCOPe Domain Sequences for d2ku1a_:

Sequence; same for both SEQRES and ATOM records:

>d2ku1a_ d.153.1.4 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
gamgmqqgqmaydraitvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrs
rlieqnsiekiqliddyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrv
adqmqqytqyggvrpygvslifagidqigprlfdcdpagtineykataigsgkdavvsfl
ereykenlpekeavtlgikalkssleegeelkapeiasitvgnkyriydqeevkkfl

Timeline for d2ku1a_:

• d2ku1a_ first appeared in SCOPe 2.04
  
• d2ku1a_ is called d2ku1a1 in SCOPe 2.06
  
• d2ku1a_ appears in the current release, SCOPe 2.08, called d2ku1a1