| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
| Family d.129.3.5: AHSA1 domain [111168] (12 proteins) Pfam PF05146 |
| Protein automated matches [254577] (2 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [255377] (1 PDB entry) |
| Domain d2ktea_: 2kte A: [242648] automated match to d1xn6a_ |
PDB Entry: 2kte (more details)
SCOPe Domain Sequences for d2ktea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ktea_ d.129.3.5 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
maqnnenalpditksitleapiqkvwetvstsegiakwfmpndfqlkegqefhlqspfgp
spckvlavqaptelsfewdtegwvvtfqledlgektgftlihsgwkepnevigkanekss
vvrgkmdggwtgivnerlrkaveelehhhhhh
Timeline for d2ktea_: