SCOPe 2.04: Domain d2ktea_: 2kte A:

Lineage for d2ktea_ (2kte A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.5: AHSA1 domain [111168] (12 proteins)
   Pfam PF05146

6. Protein automated matches [254577] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [255377] (1 PDB entry)

8. Domain d2ktea_: 2kte A: [242648]
   automated match to d1xn6a_

Details for d2ktea_

PDB Entry: 2kte

PDB Description: the solution structure of bacillus subtilis, yndb, northeast structural genomics consoritum target sr211

PDB Compounds: (A:) Uncharacterized protein yndB

SCOPe Domain Sequences for d2ktea_:

Sequence; same for both SEQRES and ATOM records:

>d2ktea_ d.129.3.5 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
maqnnenalpditksitleapiqkvwetvstsegiakwfmpndfqlkegqefhlqspfgp
spckvlavqaptelsfewdtegwvvtfqledlgektgftlihsgwkepnevigkanekss
vvrgkmdggwtgivnerlrkaveelehhhhhh

Timeline for d2ktea_:

• d2ktea_ is new in SCOPe 2.04-stable
  
• d2ktea_ appears in SCOPe 2.05
  
• d2ktea_ appears in the current release, SCOPe 2.08, called d2ktea1