SCOPe 2.08: Domain d2ktea1: 2kte A:1-144

Lineage for d2ktea1 (2kte A:1-144)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.5: AHSA1 domain [111168] (12 proteins)
   Pfam PF05146

6. Protein automated matches [254577] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [255377] (1 PDB entry)

8. Domain d2ktea1: 2kte A:1-144 [242648]
   Other proteins in same PDB: d2ktea2
   automated match to d1xn6a_

Details for d2ktea1

PDB Entry: 2kte

PDB Description: the solution structure of bacillus subtilis, yndb, northeast structural genomics consoritum target sr211

PDB Compounds: (A:) Uncharacterized protein yndB

SCOPe Domain Sequences for d2ktea1:

Sequence; same for both SEQRES and ATOM records:

>d2ktea1 d.129.3.5 (A:1-144) automated matches {Bacillus subtilis [TaxId: 1423]}
maqnnenalpditksitleapiqkvwetvstsegiakwfmpndfqlkegqefhlqspfgp
spckvlavqaptelsfewdtegwvvtfqledlgektgftlihsgwkepnevigkanekss
vvrgkmdggwtgivnerlrkavee

Timeline for d2ktea1:

• d2ktea1 first appeared in SCOPe 2.04, called d2ktea_
  
• d2ktea1 appears in SCOPe 2.07