Lineage for d2ktbb1 (2ktb B:174-293)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2706694Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2706927Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2706928Protein automated matches [190615] (15 species)
    not a true protein
  7. 2706959Species Human (Homo sapiens) [TaxId:9606] [187641] (1052 PDB entries)
  8. 2708293Domain d2ktbb1: 2ktb B:174-293 [242645]
    Other proteins in same PDB: d2ktbb2
    automated match to d3ljwb_
    protein/DNA complex

Details for d2ktbb1

PDB Entry: 2ktb (more details)

PDB Description: solution structure of the second bromodomain of human polybromo in complex with an acetylated peptide from histone 3
PDB Compounds: (B:) Protein polybromo-1

SCOPe Domain Sequences for d2ktbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ktbb1 a.29.2.0 (B:174-293) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tegsspaylkeileqlleaivvatnpsgrliselfqklpskvqypdyyaiikepidlkti
aqriqngsyksihamakdidllaknaktynepgsqvfkdansikkifymkkaeiehhema

SCOPe Domain Coordinates for d2ktbb1:

Click to download the PDB-style file with coordinates for d2ktbb1.
(The format of our PDB-style files is described here.)

Timeline for d2ktbb1: