![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) ![]() |
![]() | Family d.58.17.0: automated matches [191590] (1 protein) not a true family |
![]() | Protein automated matches [191063] (9 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [255374] (2 PDB entries) |
![]() | Domain d2kt3a_: 2kt3 A: [242643] automated match to d2aw0a_ complexed with hg |
PDB Entry: 2kt3 (more details)
SCOPe Domain Sequences for d2kt3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kt3a_ d.58.17.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]} mthlkitgmtcdscaahvkealekvpgvqsalvsypkgtaqlaivpgtspdaltaavagl gykatlada
Timeline for d2kt3a_: