Lineage for d2kt3a_ (2kt3 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2196856Superfamily d.58.17: HMA, heavy metal-associated domain [55008] (2 families) (S)
  5. 2196990Family d.58.17.0: automated matches [191590] (1 protein)
    not a true family
  6. 2196991Protein automated matches [191063] (8 species)
    not a true protein
  7. 2197008Species Pseudomonas aeruginosa [TaxId:287] [255374] (2 PDB entries)
  8. 2197010Domain d2kt3a_: 2kt3 A: [242643]
    automated match to d2aw0a_
    complexed with hg

Details for d2kt3a_

PDB Entry: 2kt3 (more details)

PDB Description: structure of hg-nmera, hg(ii) complex of the n-terminal domain of tn501 mercuric reductase
PDB Compounds: (A:) Mercuric reductase

SCOPe Domain Sequences for d2kt3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kt3a_ d.58.17.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
mthlkitgmtcdscaahvkealekvpgvqsalvsypkgtaqlaivpgtspdaltaavagl
gykatlada

SCOPe Domain Coordinates for d2kt3a_:

Click to download the PDB-style file with coordinates for d2kt3a_.
(The format of our PDB-style files is described here.)

Timeline for d2kt3a_: