SCOPe 2.08: Domain d2kt1a1: 2kt1 A:1-80

Lineage for d2kt1a1 (2kt1 A:1-80)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries)

8. Domain d2kt1a1: 2kt1 A:1-80 [242641]
   Other proteins in same PDB: d2kt1a2
   automated match to d3o5za_

Details for d2kt1a1

PDB Entry: 2kt1

PDB Description: solution nmr structure of the sh3 domain from the p85beta subunit of phosphatidylinositol 3-kinase from h.sapiens, northeast structural genomics consortium target hr5531e

PDB Compounds: (A:) Phosphatidylinositol 3-kinase regulatory subunit beta

SCOPe Domain Sequences for d2kt1a1:

Sequence; same for both SEQRES and ATOM records:

>d2kt1a1 b.34.2.0 (A:1-80) automated matches {Human (Homo sapiens) [TaxId: 9606]}
magpegfqyralypfrrerpedlellpgdvlvvsraalqalgvaeggercpqsvgwmpgl
nertrqrgdfpgtyveflgp

Timeline for d2kt1a1:

• d2kt1a1 first appeared in SCOPe 2.04, called d2kt1a_
  
• d2kt1a1 appears in SCOPe 2.07