SCOPe 2.04: Domain d2ksua_: 2ksu A:

Lineage for d2ksua_ (2ksu A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.138: Multiheme cytochromes [48694] (1 superfamily)
   variable number of helices and little beta structure; not a true fold

4. Superfamily a.138.1: Multiheme cytochromes [48695] (4 families)
   duplication: contains multiple CxxCH motifs

5. Family a.138.1.1: Cytochrome c3-like [48696] (5 proteins)

6. Protein Cytochrome c3 [48697] (7 species)
   contains four heme groups

7. Species Desulfovibrio desulfuricans, different strains [TaxId:876] [48698] (10 PDB entries)
   Uniprot Q9L915

8. Domain d2ksua_: 2ksu A: [242640]
   automated match to d1up9a_
   complexed with hem

Details for d2ksua_

PDB Entry: 2ksu

PDB Description: redox linked conformational changes in cytochrome c3 from desulfovibrio desulfuricans atcc 27774

PDB Compounds: (A:) cytochrome c3

SCOPe Domain Sequences for d2ksua_:

Sequence; same for both SEQRES and ATOM records:

>d2ksua_ a.138.1.1 (A:) Cytochrome c3 {Desulfovibrio desulfuricans, different strains [TaxId: 876]}
apavpdkpvevkgsqktvmfphaphekvecvtchhlvdgkesyakcgssgchddltakkg
ekslyyvvhargelkhtsclachskvvaekpelkkdltgcakskchp

Timeline for d2ksua_:

• d2ksua_ is new in SCOPe 2.04-stable
  
• d2ksua_ appears in SCOPe 2.05
  
• d2ksua_ appears in the current release, SCOPe 2.08