SCOPe 2.08: Domain d2ksob_: 2kso B:

Lineage for d2ksob_ (2kso B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.1: SAM/Pointed domain [47769] (4 families)

5. Family a.60.1.0: automated matches [191306] (1 protein)
   not a true family

6. Protein automated matches [190031] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188353] (24 PDB entries)

8. Domain d2ksob_: 2kso B: [242637]
   automated match to d2qkqa_

Details for d2ksob_

PDB Entry: 2kso

PDB Description: epha2:ship2 sam:sam complex

PDB Compounds: (B:) Phosphatidylinositol-3,4,5-trisphosphate 5-phosphatase 2

SCOPe Domain Sequences for d2ksob_:

Sequence; same for both SEQRES and ATOM records:

>d2ksob_ a.60.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gmsawlraigleryeeglvhngwddleflsditeedleeagvqdpahkrllldtlqlsk

Timeline for d2ksob_:

• d2ksob_ first appeared in SCOPe 2.04
  
• d2ksob_ appears in SCOPe 2.07