Lineage for d2ksca_ (2ksc A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1473061Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 1473062Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 1473063Family a.1.1.1: Truncated hemoglobin [46459] (2 proteins)
    lack the first helix (A)
  6. 1473123Protein automated matches [190322] (3 species)
    not a true protein
  7. 1473127Species Synechococcus sp. [TaxId:32049] [194261] (3 PDB entries)
  8. 1473133Domain d2ksca_: 2ksc A: [242632]
    automated match to d4maxa_
    complexed with heb

Details for d2ksca_

PDB Entry: 2ksc (more details)

PDB Description: solution structure of synechococcus sp. pcc 7002 hemoglobin
PDB Compounds: (A:) Cyanoglobin

SCOPe Domain Sequences for d2ksca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ksca_ a.1.1.1 (A:) automated matches {Synechococcus sp. [TaxId: 32049]}
aslyeklggaaavdlavekfygkvladervnrffvntdmakqkqhqkdfmtyafggtdrf
pgrsmraahqdlvenagltdvhfdaiaenlvltlqelnvsqdlidevvtivgsvqhrndv
lnr

SCOPe Domain Coordinates for d2ksca_:

Click to download the PDB-style file with coordinates for d2ksca_.
(The format of our PDB-style files is described here.)

Timeline for d2ksca_: