SCOPe 2.07: Domain d2ks4a_: 2ks4 A:

Lineage for d2ks4a_ (2ks4 A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.97: Cytolysin/lectin [63723] (1 superfamily)
   sandwich, 10 strands in 2 sheets;

4. Superfamily b.97.1: Cytolysin/lectin [63724] (2 families)
   some topological similarity to osmotin

5. Family b.97.1.1: Anemone pore-forming cytolysin [63725] (3 proteins)
   Pfam PF06369

6. Protein automated matches [254587] (1 species)
   not a true protein

7. Species Sea anemone (Stichodactyla helianthus) [TaxId:6123] [255372] (1 PDB entry)

8. Domain d2ks4a_: 2ks4 A: [242631]
   automated match to d1kd6a_

Details for d2ks4a_

PDB Entry: 2ks4

PDB Description: NMR structure of the sea anemone actinoporin Sticholysin

PDB Compounds: (A:) Sticholysin-1

SCOPe Domain Sequences for d2ks4a_:

Sequence; same for both SEQRES and ATOM records:

>d2ks4a_ b.97.1.1 (A:) automated matches {Sea anemone (Stichodactyla helianthus) [TaxId: 6123]}
selagtiidgasltfevldkvlgelgkvsrkiavgidnesggtwtalnayfrsgttdvil
pevvpntkallysgrkssgpvatgavaafayymsngntlgvmfsvpfdynwysnwwdvki
ypgkrradqgmyedmyygnpyrgdngwyqknlgyglrmkgimtsageakmqikisr

Timeline for d2ks4a_:

• d2ks4a_ first appeared in SCOPe 2.04
  
• d2ks4a_ appears in SCOPe 2.06
  
• d2ks4a_ appears in the current release, SCOPe 2.08