Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (68 proteins) |
Protein Nucleolin [54952] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [255371] (1 PDB entry) |
Domain d2krra2: 2krr A:86-170 [242630] Other proteins in same PDB: d2krra3 automated match to d1fjeb2 |
PDB Entry: 2krr (more details)
SCOPe Domain Sequences for d2krra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2krra2 d.58.7.1 (A:86-170) Nucleolin {Human (Homo sapiens) [TaxId: 9606]} dskkerdartllaknlpykvtqdelkevfedaaeirlvskdgkskgiayiefkteadaek tfeekqgteidgrsislyytgepkg
Timeline for d2krra2: