Lineage for d2krra2 (2krr A:86-170)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2195050Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) (S)
  5. 2195051Family d.58.7.1: Canonical RBD [54929] (68 proteins)
  6. 2195210Protein Nucleolin [54952] (2 species)
  7. 2195218Species Human (Homo sapiens) [TaxId:9606] [255371] (1 PDB entry)
  8. 2195220Domain d2krra2: 2krr A:86-170 [242630]
    Other proteins in same PDB: d2krra3
    automated match to d1fjeb2

Details for d2krra2

PDB Entry: 2krr (more details)

PDB Description: solution structure of the rbd1,2 domains from human nucleolin
PDB Compounds: (A:) Nucleolin

SCOPe Domain Sequences for d2krra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2krra2 d.58.7.1 (A:86-170) Nucleolin {Human (Homo sapiens) [TaxId: 9606]}
dskkerdartllaknlpykvtqdelkevfedaaeirlvskdgkskgiayiefkteadaek
tfeekqgteidgrsislyytgepkg

SCOPe Domain Coordinates for d2krra2:

Click to download the PDB-style file with coordinates for d2krra2.
(The format of our PDB-style files is described here.)

Timeline for d2krra2: