Lineage for d2krna1 (2krn A:5-60)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2392350Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2392486Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2392985Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 2392986Protein automated matches [190457] (10 species)
    not a true protein
  7. 2393245Species Mouse (Mus musculus) [TaxId:10090] [189303] (27 PDB entries)
  8. 2393266Domain d2krna1: 2krn A:5-60 [242627]
    Other proteins in same PDB: d2krna2
    automated match to d2drka_

Details for d2krna1

PDB Entry: 2krn (more details)

PDB Description: High resolution structure of the second SH3 domain of CD2AP
PDB Compounds: (A:) CD2-associated protein

SCOPe Domain Sequences for d2krna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2krna1 b.34.2.0 (A:5-60) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rqckvlfdyspqnedelelivgdvidvieeveegwwsgtlnnklglfpsnfvkele

SCOPe Domain Coordinates for d2krna1:

Click to download the PDB-style file with coordinates for d2krna1.
(The format of our PDB-style files is described here.)

Timeline for d2krna1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2krna2