| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
| Protein automated matches [190457] (10 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [189303] (27 PDB entries) |
| Domain d2krna1: 2krn A:5-60 [242627] Other proteins in same PDB: d2krna2 automated match to d2drka_ |
PDB Entry: 2krn (more details)
SCOPe Domain Sequences for d2krna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2krna1 b.34.2.0 (A:5-60) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rqckvlfdyspqnedelelivgdvidvieeveegwwsgtlnnklglfpsnfvkele
Timeline for d2krna1: