Class g: Small proteins [56992] (98 folds) |
Fold g.18: Complement control module/SCR domain [57534] (1 superfamily) disulfide-rich all-beta fold |
Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) |
Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins) Pfam PF00084 |
Protein beta2-glycoprotein I [57543] (1 species) consists of five modules with the C-terminal module fold being altered |
Species Human (Homo sapiens) [TaxId:9606] [57544] (9 PDB entries) |
Domain d2kria_: 2kri A: [242624] Other proteins in same PDB: d2krib_ automated match to d3op8a_ complexed with ca |
PDB Entry: 2kri (more details)
SCOPe Domain Sequences for d2kria_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kria_ g.18.1.1 (A:) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]} cklpvkkatvvyqgervkiqekfkngmlhgdkvsffcknkekkcsytedaqcidgtievp kcfkehsslafwktdasdvkpc
Timeline for d2kria_: