Lineage for d2kria_ (2kri A:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2638750Fold g.18: Complement control module/SCR domain [57534] (1 superfamily)
    disulfide-rich all-beta fold
  4. 2638751Superfamily g.18.1: Complement control module/SCR domain [57535] (2 families) (S)
  5. 2638752Family g.18.1.1: Complement control module/SCR domain [57536] (15 proteins)
    Pfam PF00084
  6. 2638753Protein beta2-glycoprotein I [57543] (1 species)
    consists of five modules with the C-terminal module fold being altered
  7. 2638754Species Human (Homo sapiens) [TaxId:9606] [57544] (9 PDB entries)
  8. 2638781Domain d2kria_: 2kri A: [242624]
    Other proteins in same PDB: d2krib_
    automated match to d3op8a_
    complexed with ca

Details for d2kria_

PDB Entry: 2kri (more details)

PDB Description: structure of a complex between domain v of beta2-glycoprotein i and the fourth ligand-binding module from ldlr determined with haddock
PDB Compounds: (A:) Beta-2-glycoprotein 1

SCOPe Domain Sequences for d2kria_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kria_ g.18.1.1 (A:) beta2-glycoprotein I {Human (Homo sapiens) [TaxId: 9606]}
cklpvkkatvvyqgervkiqekfkngmlhgdkvsffcknkekkcsytedaqcidgtievp
kcfkehsslafwktdasdvkpc

SCOPe Domain Coordinates for d2kria_:

Click to download the PDB-style file with coordinates for d2kria_.
(The format of our PDB-style files is described here.)

Timeline for d2kria_: