Lineage for d2kqxa_ (2kqx A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2689868Superfamily a.2.3: Chaperone J-domain [46565] (2 families) (S)
  5. 2689904Family a.2.3.0: automated matches [191473] (1 protein)
    not a true family
  6. 2689905Protein automated matches [190750] (8 species)
    not a true protein
  7. 2689912Species Escherichia coli K-12 [TaxId:83333] [226715] (2 PDB entries)
  8. 2689915Domain d2kqxa_: 2kqx A: [242621]
    automated match to d3ucsc_

Details for d2kqxa_

PDB Entry: 2kqx (more details)

PDB Description: nmr structure of the j-domain (residues 2-72) in the escherichia coli cbpa
PDB Compounds: (A:) Curved DNA-binding protein

SCOPe Domain Sequences for d2kqxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kqxa_ a.2.3.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}
elkdyyaimgvkptddlktiktayrrlarkyhpdvskepdaearfkevaeawevlsdeqr
raeydqmwqhr

SCOPe Domain Coordinates for d2kqxa_:

Click to download the PDB-style file with coordinates for d2kqxa_.
(The format of our PDB-style files is described here.)

Timeline for d2kqxa_: