Lineage for d2kqua1 (2kqu A:2-169)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.5: Flavoproteins [52218] (9 families) 
Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
binds FMNProtein automated matches [190443] (6 species)
not a true protein
Species Anabaena sp. [TaxId:1168] [188238] (5 PDB entries) 
Domain d2kqua1: 2kqu A:2-169 [242620]
Other proteins in same PDB: d2kqua2
automated match to d1obva_
Details for d2kqua1
PDB Entry: 2kqu (more details)
PDB Description: F98N apoflavodoxin from Anabaena PCC 7119
PDB Compounds: (A:) flavodoxinSCOPe Domain Sequences for d2kqua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kqua1 c.23.5.1 (A:2-169) automated matches {Anabaena sp. [TaxId: 1168]}
kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnige
lqsdweglyselddvdfngklvayfgtgdqigyadnnqdaigileekisqrggktvgyws
tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl
SCOPe Domain Coordinates for d2kqua1:
Click to download the PDB-style file with coordinates for d2kqua1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2kqua1:
- d2kqua1 first appeared in SCOPe 2.04, called d2kqua_
- d2kqua1 appears in SCOPe 2.07
View in 3D
