Lineage for d2kqua1 (2kqu A:2-169)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856358Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
    binds FMN
  6. 2856472Protein automated matches [190443] (6 species)
    not a true protein
  7. 2856473Species Anabaena sp. [TaxId:1168] [188238] (5 PDB entries)
  8. 2856484Domain d2kqua1: 2kqu A:2-169 [242620]
    Other proteins in same PDB: d2kqua2
    automated match to d1obva_

Details for d2kqua1

PDB Entry: 2kqu (more details)

PDB Description: F98N apoflavodoxin from Anabaena PCC 7119
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d2kqua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kqua1 c.23.5.1 (A:2-169) automated matches {Anabaena sp. [TaxId: 1168]}
kkiglfygtqtgktesvaeiirdefgndvvtlhdvsqaevtdlndyqyliigcptwnige
lqsdweglyselddvdfngklvayfgtgdqigyadnnqdaigileekisqrggktvgyws
tdgydfndskalrngkfvglaldednqsdltddrikswvaqlksefgl

SCOPe Domain Coordinates for d2kqua1:

Click to download the PDB-style file with coordinates for d2kqua1.
(The format of our PDB-style files is described here.)

Timeline for d2kqua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kqua2