Lineage for d1a8da1 (1a8d A:1-247)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2043490Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (3 protein domains)
    automatically mapped to Pfam PF07953
  6. 2043515Protein Tetanus neurotoxin [49957] (1 species)
  7. 2043516Species Clostridium tetani [TaxId:1513] [49958] (10 PDB entries)
  8. 2043517Domain d1a8da1: 1a8d A:1-247 [24262]
    Other proteins in same PDB: d1a8da2
    complexed with au

Details for d1a8da1

PDB Entry: 1a8d (more details), 1.57 Å

PDB Description: tetanus toxin c fragment
PDB Compounds: (A:) tetanus neurotoxin

SCOPe Domain Sequences for d1a8da1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a8da1 b.29.1.6 (A:1-247) Tetanus neurotoxin {Clostridium tetani [TaxId: 1513]}
mknldcwvdneedidvilkkstilnldinndiisdisgfnssvitypdaqlvpgingkai
hlvnnessevivhkamdieyndmfnnftvsfwlrvpkvsashleqygtneysiissmkkh
slsigsgwsvslkgnnliwtlkdsagevrqitfrdlpdkfnaylankwvfititndrlss
anlyingvlmgsaeitglgairednnitlkldrcnnnnqyvsidkfrifckalnpkeiek
lytsyls

SCOPe Domain Coordinates for d1a8da1:

Click to download the PDB-style file with coordinates for d1a8da1.
(The format of our PDB-style files is described here.)

Timeline for d1a8da1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a8da2