SCOPe 2.08: Domain d2kqna_: 2kqn A:

Lineage for d2kqna_ (2kqn A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d2kqna_: 2kqn A: [242618]
   automated match to d3u79a_

Details for d2kqna_

PDB Entry: 2kqn

PDB Description: solution structure of the al-09 h87y immunoglobulin light chain variable domain

PDB Compounds: (A:) Ig kappa chain V-I region AU

SCOPe Domain Sequences for d2kqna_:

Sequence; same for both SEQRES and ATOM records:

>d2kqna_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdinnyliwyqqkpgqapklliydastletgvps
rfsgsgsgteftftisslqpedlatyycqqydnlpytfgqgtkleikr

Timeline for d2kqna_:

• d2kqna_ first appeared in SCOPe 2.04
  
• d2kqna_ appears in SCOPe 2.07