SCOPe 2.06: Domain d2kqma_: 2kqm A:

Lineage for d2kqma_ (2kqm A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (183 PDB entries)

8. Domain d2kqma_: 2kqm A: [242616]
   automated match to d3u79a_

Details for d2kqma_

PDB Entry: 2kqm

PDB Description: Solution structure of the KI O18/O8 Y87H immunoglobulin light chain variable domain

PDB Compounds: (A:) Ig kappa chain V-I region AU

SCOPe Domain Sequences for d2kqma_:

Sequence; same for both SEQRES and ATOM records:

>d2kqma_ b.1.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
diqmtqspsslsasvgdrvtitcqasqdisnylnwyqqkpgkapklliydasnletgvps
rfsgsgsgtdftftisslqpediatyhcqqydnlpytfgqgtkleikr

Timeline for d2kqma_:

• d2kqma_ first appeared in SCOPe 2.04
  
• d2kqma_ appears in SCOPe 2.05
  
• d2kqma_ appears in SCOPe 2.07
  
• d2kqma_ appears in the current release, SCOPe 2.08