![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
![]() | Superfamily d.224.1: SufE/NifU [82649] (4 families) ![]() iron-sulfur cluster assembly proteins |
![]() | Family d.224.1.2: NifU/IscU domain [102928] (5 proteins) |
![]() | Protein automated matches [254586] (5 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [255370] (1 PDB entry) |
![]() | Domain d2kqka_: 2kqk A: [242615] automated match to d1r9pa_ |
PDB Entry: 2kqk (more details)
SCOPe Domain Sequences for d2kqka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kqka_ d.224.1.2 (A:) automated matches {Escherichia coli [TaxId: 562]} maysekvidhyenprnvgsfdnndenvgsgmvgapacgavmklqikvndegiiedarfkt ygcgsaiassslvtewvkgksldeaqaikntdiaeelelppvkihcsilaedaikaaiad ykskreak
Timeline for d2kqka_: