SCOPe 2.04: Domain d2kpwa_: 2kpw A:

Lineage for d2kpwa_ (2kpw A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.16: Lamin A/C globular tail domain [74853] (2 families)

5. Family b.1.16.0: automated matches [191666] (1 protein)
   not a true family

6. Protein automated matches [191265] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189832] (4 PDB entries)

8. Domain d2kpwa_: 2kpw A: [242612]
   automated match to d1ivta_

Details for d2kpwa_

PDB Entry: 2kpw

PDB Description: nmr solution structure of lamin-b1 protein from homo sapiens: northeast structural genomics consortium mega target, hr5546a (439- 549)

PDB Compounds: (A:) Lamin-B1

SCOPe Domain Sequences for d2kpwa_:

Sequence; same for both SEQRES and ATOM records:

>d2kpwa_ b.1.16.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mghhhhhhshmtgnvcieeidvdgkfirlkntseqdqpmggwemirkigdtsvsykytsr
yvlkagqtvtiwaanagvtaspptdliwknqnswgtgedvkvilknsqgeevaqrstvfk
tt

Timeline for d2kpwa_:

• d2kpwa_ is new in SCOPe 2.04-stable
  
• d2kpwa_ appears in SCOPe 2.05
  
• d2kpwa_ appears in the current release, SCOPe 2.08, called d2kpwa1