Lineage for d2kpwa1 (2kpw A:12-122)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2764999Superfamily b.1.16: Lamin A/C globular tail domain [74853] (2 families) (S)
  5. 2765016Family b.1.16.0: automated matches [191666] (1 protein)
    not a true family
  6. 2765017Protein automated matches [191265] (1 species)
    not a true protein
  7. 2765018Species Human (Homo sapiens) [TaxId:9606] [189832] (5 PDB entries)
  8. 2765027Domain d2kpwa1: 2kpw A:12-122 [242612]
    Other proteins in same PDB: d2kpwa2
    automated match to d1ivta_

Details for d2kpwa1

PDB Entry: 2kpw (more details)

PDB Description: nmr solution structure of lamin-b1 protein from homo sapiens: northeast structural genomics consortium mega target, hr5546a (439- 549)
PDB Compounds: (A:) Lamin-B1

SCOPe Domain Sequences for d2kpwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kpwa1 b.1.16.0 (A:12-122) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgnvcieeidvdgkfirlkntseqdqpmggwemirkigdtsvsykytsryvlkagqtvti
waanagvtaspptdliwknqnswgtgedvkvilknsqgeevaqrstvfktt

SCOPe Domain Coordinates for d2kpwa1:

Click to download the PDB-style file with coordinates for d2kpwa1.
(The format of our PDB-style files is described here.)

Timeline for d2kpwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2kpwa2