Class b: All beta proteins [48724] (126 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (15 families) |
Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins) |
Protein C-reactive protein (CRP) [49954] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49955] (3 PDB entries) |
Domain d1gnhj_: 1gnh J: [24261] complexed with ca |
PDB Entry: 1gnh (more details), 3 Å
SCOP Domain Sequences for d1gnhj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1gnhj_ b.29.1.5 (J:) C-reactive protein (CRP) {Human (Homo sapiens)} qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf spnvlnwralkyevqgevftkpqlwp
Timeline for d1gnhj_: