Lineage for d1gnhj_ (1gnh J:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 57551Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 57552Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 57942Family b.29.1.5: Pentraxin (pentaxin) [49951] (2 proteins)
  6. 57943Protein C-reactive protein (CRP) [49954] (1 species)
  7. 57944Species Human (Homo sapiens) [TaxId:9606] [49955] (2 PDB entries)
  8. 57959Domain d1gnhj_: 1gnh J: [24261]

Details for d1gnhj_

PDB Entry: 1gnh (more details), 3 Å

PDB Description: human c-reactive protein

SCOP Domain Sequences for d1gnhj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gnhj_ b.29.1.5 (J:) C-reactive protein (CRP) {Human (Homo sapiens)}
qtdmsrkafvfpkesdtsyvslkapltkplkaftvclhfytelsstrgysifsyatkrqd
neilifwskdigysftvggseilfevpevtvapvhictswesasgivefwvdgkprvrks
lkkgytvgaeasiilgqeqdsfggnfegsqslvgdignvnmwdfvlspdeintiylggpf
spnvlnwralkyevqgevftkpqlwp

SCOP Domain Coordinates for d1gnhj_:

Click to download the PDB-style file with coordinates for d1gnhj_.
(The format of our PDB-style files is described here.)

Timeline for d1gnhj_: