SCOPe 2.07: Domain d2kpha_: 2kph A:

Lineage for d2kpha_ (2kph A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.2: Insect pheromone/odorant-binding proteins [47565] (2 families)
   the N-terminal extension, containing a few short helices, forms a flexible lid for the binding cavity

5. Family a.39.2.1: Insect pheromone/odorant-binding proteins [47566] (6 proteins)
   automatically mapped to Pfam PF01395

6. Protein automated matches [190345] (4 species)
   not a true protein

7. Species Amyelois transitella [TaxId:680683] [193910] (3 PDB entries)

8. Domain d2kpha_: 2kph A: [242609]
   automated match to d1qwva_

Details for d2kpha_

PDB Entry: 2kph

PDB Description: nmr structure of atrapbp1 at ph 4.5

PDB Compounds: (A:) pheromone binding protein

SCOPe Domain Sequences for d2kpha_:

Sequence; same for both SEQRES and ATOM records:

>d2kpha_ a.39.2.1 (A:) automated matches {Amyelois transitella [TaxId: 680683]}
speimkdlsinfgkaldtckkeldlpdsinedfykfwkedyeitnrltgcaikclsekle
mvdadgklhhgnarefamkhgaddamakqlvdlihgceksippnddrcmevlsiamcfkk
eihnlkwapnmevvvgevlaev

Timeline for d2kpha_:

• d2kpha_ first appeared in SCOPe 2.04
  
• d2kpha_ appears in SCOPe 2.06
  
• d2kpha_ appears in the current release, SCOPe 2.08