Lineage for d2kp2a_ (2kp2 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1600752Family c.47.1.2: PDI-like [52849] (3 proteins)
    duplication: contains two tandem repeats of this fold
  6. 1600765Protein Protein disulfide isomerase, PDI [52850] (5 species)
  7. 1600771Species Fungus (Humicola insolens) [TaxId:34413] [142357] (3 PDB entries)
    Uniprot P55059 227-355! Uniprot P55059 350-459
  8. 1600772Domain d2kp2a_: 2kp2 A: [242607]
    automated match to d2djka1

Details for d2kp2a_

PDB Entry: 2kp2 (more details)

PDB Description: Solution structure of the b' domain of thermophilic fungal protein disulfide isomerase
PDB Compounds: (A:) Protein disulfide-isomerase

SCOPe Domain Sequences for d2kp2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kp2a_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Fungus (Humicola insolens) [TaxId: 34413]}
gplgspligeigpetysdymsagiplayifaetaeerkelsdklkpiaeaqrgvinfgti
dakafgahagnlnlktdkfpafaiqevaknqkfpfdqekeitfeaikafvddfvagkiep
siksepipekqeg

SCOPe Domain Coordinates for d2kp2a_:

Click to download the PDB-style file with coordinates for d2kp2a_.
(The format of our PDB-style files is described here.)

Timeline for d2kp2a_: