![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.1: ACP-like [47336] (4 families) ![]() |
![]() | Family a.28.1.0: automated matches [191582] (1 protein) not a true family |
![]() | Protein automated matches [191038] (29 species) not a true protein |
![]() | Species Streptomyces coelicolor [TaxId:1902] [255367] (5 PDB entries) |
![]() | Domain d2koqa_: 2koq A: [242601] automated match to d1x3oa_ complexed with shw |
PDB Entry: 2koq (more details)
SCOPe Domain Sequences for d2koqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2koqa_ a.28.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]} aatqeeivaglaeivneiagipvedvkldksftddldvdslsmvevvvaaeerfdvkipd ddvknlktvgdatkyildhqa
Timeline for d2koqa_: