SCOPe 2.06: Domain d2kopa_: 2kop A:

Lineage for d2kopa_ (2kop A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (20 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:1902] [255367] (5 PDB entries)

8. Domain d2kopa_: 2kop A: [242600]
   automated match to d1x3oa_
   complexed with syo

Details for d2kopa_

PDB Entry: 2kop

PDB Description: nmr solution structures of 3-oxooctanyl-acp from streptomyces coelicolor fatty acid synthase

PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2kopa_:

Sequence; same for both SEQRES and ATOM records:

>d2kopa_ a.28.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
aatqeeivaglaeivneiagipvedvkldksftddldvdslsmvevvvaaeerfdvkipd
ddvknlktvgdatkyildhqa

Timeline for d2kopa_:

• d2kopa_ first appeared in SCOPe 2.04
  
• d2kopa_ appears in SCOPe 2.05
  
• d2kopa_ appears in SCOPe 2.07
  
• d2kopa_ appears in the current release, SCOPe 2.08