SCOPe 2.05: Domain d2kooa_: 2koo A:

Lineage for d2kooa_ (2koo A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.0: automated matches [191582] (1 protein)
   not a true family

6. Protein automated matches [191038] (17 species)
   not a true protein

7. Species Streptomyces coelicolor [TaxId:1902] [255367] (5 PDB entries)

8. Domain d2kooa_: 2koo A: [242599]
   automated match to d1x3oa_
   complexed with sxh

Details for d2kooa_

PDB Entry: 2koo

PDB Description: nmr solution structures of hexanoyl-acp from the streptomyces coelicolor fatty acid synthase

PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2kooa_:

Sequence; same for both SEQRES and ATOM records:

>d2kooa_ a.28.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
aatqeeivaglaeivneiagipvedvkldksftddldvdslsmvevvvaaeerfdvkipd
ddvknlktvgdatkyildhqa

Timeline for d2kooa_:

• d2kooa_ first appeared in SCOPe 2.04
  
• d2kooa_ appears in SCOPe 2.06
  
• d2kooa_ appears in the current release, SCOPe 2.08