Lineage for d2kooa_ (2koo A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706109Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 2706248Family a.28.1.0: automated matches [191582] (1 protein)
    not a true family
  6. 2706249Protein automated matches [191038] (29 species)
    not a true protein
  7. 2706374Species Streptomyces coelicolor [TaxId:1902] [255367] (5 PDB entries)
  8. 2706379Domain d2kooa_: 2koo A: [242599]
    automated match to d1x3oa_
    complexed with sxh

Details for d2kooa_

PDB Entry: 2koo (more details)

PDB Description: nmr solution structures of hexanoyl-acp from the streptomyces coelicolor fatty acid synthase
PDB Compounds: (A:) Acyl carrier protein

SCOPe Domain Sequences for d2kooa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kooa_ a.28.1.0 (A:) automated matches {Streptomyces coelicolor [TaxId: 1902]}
aatqeeivaglaeivneiagipvedvkldksftddldvdslsmvevvvaaeerfdvkipd
ddvknlktvgdatkyildhqa

SCOPe Domain Coordinates for d2kooa_:

Click to download the PDB-style file with coordinates for d2kooa_.
(The format of our PDB-style files is described here.)

Timeline for d2kooa_: