Lineage for d2kola_ (2kol A:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2499233Fold d.9: IL8-like [54116] (2 superfamilies)
    beta(3)-alpha
  4. 2499234Superfamily d.9.1: Interleukin 8-like chemokines [54117] (2 families) (S)
    form dimers with different dimerisation modes
  5. 2499235Family d.9.1.1: Interleukin 8-like chemokines [54118] (25 protein domains)
  6. 2499499Protein Stromal cell-derived factor-1 (SDF-1) [54150] (1 species)
  7. 2499500Species Human (Homo sapiens) [TaxId:9606] [54151] (20 PDB entries)
  8. 2499530Domain d2kola_: 2kol A: [242597]
    automated match to d2j7za_

Details for d2kola_

PDB Entry: 2kol (more details)

PDB Description: Solution structure of human SDF1-alpha H25R
PDB Compounds: (A:) Stromal cell-derived factor 1

SCOPe Domain Sequences for d2kola_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2kola_ d.9.1.1 (A:) Stromal cell-derived factor-1 (SDF-1) {Human (Homo sapiens) [TaxId: 9606]}
kpvslsyrcpcrffeshvaranvkrlkilntpncalqivarlknnnrqvcidpklkwiqe
ylekalnk

SCOPe Domain Coordinates for d2kola_:

Click to download the PDB-style file with coordinates for d2kola_.
(The format of our PDB-style files is described here.)

Timeline for d2kola_: