Class b: All beta proteins [48724] (178 folds) |
Fold b.36: PDZ domain-like [50155] (1 superfamily) contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix |
Superfamily b.36.1: PDZ domain-like [50156] (7 families) peptide-binding domain |
Family b.36.1.0: automated matches [191362] (1 protein) not a true family |
Protein automated matches [190436] (9 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [189959] (17 PDB entries) |
Domain d2koja1: 2koj A:450-558 [242595] Other proteins in same PDB: d2koja2 automated match to d2opga_ |
PDB Entry: 2koj (more details)
SCOPe Domain Sequences for d2koja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2koja1 b.36.1.0 (A:450-558) automated matches {Mouse (Mus musculus) [TaxId: 10090]} vyntkkvgkrlniqlkkgteglgfsitsrdvtiggsapiyvknilprgaaiqdgrlkagd rlievngvdlagksqeevvsllrstkmegtvsllvfrqeeafhpremna
Timeline for d2koja1: