Lineage for d2koja1 (2koj A:450-558)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2396113Family b.36.1.0: automated matches [191362] (1 protein)
    not a true family
  6. 2396114Protein automated matches [190436] (9 species)
    not a true protein
  7. 2396313Species Mouse (Mus musculus) [TaxId:10090] [189959] (17 PDB entries)
  8. 2396333Domain d2koja1: 2koj A:450-558 [242595]
    Other proteins in same PDB: d2koja2
    automated match to d2opga_

Details for d2koja1

PDB Entry: 2koj (more details)

PDB Description: solution structure of mouse par-3 pdz2 (residues 450-558)
PDB Compounds: (A:) Partitioning defective 3 homolog

SCOPe Domain Sequences for d2koja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2koja1 b.36.1.0 (A:450-558) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vyntkkvgkrlniqlkkgteglgfsitsrdvtiggsapiyvknilprgaaiqdgrlkagd
rlievngvdlagksqeevvsllrstkmegtvsllvfrqeeafhpremna

SCOPe Domain Coordinates for d2koja1:

Click to download the PDB-style file with coordinates for d2koja1.
(The format of our PDB-style files is described here.)

Timeline for d2koja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2koja2