SCOPe 2.05: Domain d2koia_: 2koi A:

Lineage for d2koia_ (2koi A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.1: GAF domain [55782] (8 proteins)

6. Protein Sensor protein CYB2465 [160659] (2 species)

7. Species Synechococcus sp. [TaxId:1131] [160660] (4 PDB entries)
   Uniprot Q2JIZ5 31-200

8. Domain d2koia_: 2koi A: [242594]
   automated match to d2k2na1
   complexed with cyc

Details for d2koia_

PDB Entry: 2koi

PDB Description: Refined solution structure of a cyanobacterial phytochrome GAF domain in the red light-absorbing ground state

PDB Compounds: (A:) Sensor protein

SCOPe Domain Sequences for d2koia_:

Sequence; same for both SEQRES and ATOM records:

>d2koia_ d.110.2.1 (A:) Sensor protein CYB2465 {Synechococcus sp. [TaxId: 1131]}
ldqilratveevraflgtdrvkvyrfdpeghgtvvaearggerlpsllgltfpagdipee
arrlfrlaqvrvivdveaqsrsisqpeswglsarvplgeplqrpvdpchvhylksmgvas
slvvplmhhqelwgllvshhaeprpysqeelqvvqlladqvsiaiaqaelsl

Timeline for d2koia_:

• d2koia_ first appeared in SCOPe 2.04
  
• d2koia_ is called d2koia1 in SCOPe 2.06
  
• d2koia_ appears in the current release, SCOPe 2.08, called d2koia1