Lineage for d2koia_ (2koi A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1665312Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 1665377Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 1665378Family d.110.2.1: GAF domain [55782] (8 proteins)
  6. 1665423Protein Sensor protein CYB2465 [160659] (2 species)
  7. 1665424Species Synechococcus sp. [TaxId:1131] [160660] (4 PDB entries)
    Uniprot Q2JIZ5 31-200
  8. 1665426Domain d2koia_: 2koi A: [242594]
    automated match to d2k2na1
    complexed with cyc

Details for d2koia_

PDB Entry: 2koi (more details)

PDB Description: Refined solution structure of a cyanobacterial phytochrome GAF domain in the red light-absorbing ground state
PDB Compounds: (A:) Sensor protein

SCOPe Domain Sequences for d2koia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2koia_ d.110.2.1 (A:) Sensor protein CYB2465 {Synechococcus sp. [TaxId: 1131]}
ldqilratveevraflgtdrvkvyrfdpeghgtvvaearggerlpsllgltfpagdipee
arrlfrlaqvrvivdveaqsrsisqpeswglsarvplgeplqrpvdpchvhylksmgvas
slvvplmhhqelwgllvshhaeprpysqeelqvvqlladqvsiaiaqaelsl

SCOPe Domain Coordinates for d2koia_:

Click to download the PDB-style file with coordinates for d2koia_.
(The format of our PDB-style files is described here.)

Timeline for d2koia_: