Lineage for d2koia1 (2koi A:31-200)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970136Family d.110.2.1: GAF domain [55782] (8 proteins)
  6. 2970186Protein Sensor protein CYB2465 [160659] (2 species)
  7. 2970187Species Synechococcus sp. [TaxId:1131] [160660] (4 PDB entries)
    Uniprot Q2JIZ5 31-200
  8. 2970189Domain d2koia1: 2koi A:31-200 [242594]
    Other proteins in same PDB: d2koia2
    automated match to d2k2na1
    complexed with cyc

Details for d2koia1

PDB Entry: 2koi (more details)

PDB Description: Refined solution structure of a cyanobacterial phytochrome GAF domain in the red light-absorbing ground state
PDB Compounds: (A:) Sensor protein

SCOPe Domain Sequences for d2koia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2koia1 d.110.2.1 (A:31-200) Sensor protein CYB2465 {Synechococcus sp. [TaxId: 1131]}
ldqilratveevraflgtdrvkvyrfdpeghgtvvaearggerlpsllgltfpagdipee
arrlfrlaqvrvivdveaqsrsisqpeswglsarvplgeplqrpvdpchvhylksmgvas
slvvplmhhqelwgllvshhaeprpysqeelqvvqlladqvsiaiaqael

SCOPe Domain Coordinates for d2koia1:

Click to download the PDB-style file with coordinates for d2koia1.
(The format of our PDB-style files is described here.)

Timeline for d2koia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2koia2