| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
| Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins) |
| Protein automated matches [226861] (4 species) not a true protein |
| Species Hiv-1 m:b_hxb2r [TaxId:11706] [255365] (1 PDB entry) |
| Domain d2kodb_: 2kod B: [242592] automated match to d2xt1a_ |
PDB Entry: 2kod (more details)
SCOPe Domain Sequences for d2kodb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2kodb_ a.28.3.1 (B:) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
mysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilk
algpaatleemmtacqgvggpghkarvl
Timeline for d2kodb_: