SCOPe 2.08: Domain d2kodb_: 2kod B:

Lineage for d2kodb_ (2kod B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)

6. Protein automated matches [226861] (4 species)
   not a true protein

7. Species Hiv-1 m:b_hxb2r [TaxId:11706] [255365] (1 PDB entry)

8. Domain d2kodb_: 2kod B: [242592]
   automated match to d2xt1a_

Details for d2kodb_

PDB Entry: 2kod

PDB Description: A high-resolution NMR structure of the dimeric C-terminal domain of HIV-1 CA

PDB Compounds: (B:) HIV-1 CA C-terminal domain

SCOPe Domain Sequences for d2kodb_:

Sequence; same for both SEQRES and ATOM records:

>d2kodb_ a.28.3.1 (B:) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
mysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilk
algpaatleemmtacqgvggpghkarvl

Timeline for d2kodb_:

• d2kodb_ first appeared in SCOPe 2.04
  
• d2kodb_ appears in SCOPe 2.07