Lineage for d2koda_ (2kod A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706108Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2706465Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2706466Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)
  6. 2706520Protein automated matches [226861] (4 species)
    not a true protein
  7. 2706521Species Hiv-1 m:b_hxb2r [TaxId:11706] [255365] (1 PDB entry)
  8. 2706522Domain d2koda_: 2kod A: [242591]
    automated match to d2xt1a_

Details for d2koda_

PDB Entry: 2kod (more details)

PDB Description: A high-resolution NMR structure of the dimeric C-terminal domain of HIV-1 CA
PDB Compounds: (A:) HIV-1 CA C-terminal domain

SCOPe Domain Sequences for d2koda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2koda_ a.28.3.1 (A:) automated matches {Hiv-1 m:b_hxb2r [TaxId: 11706]}
mysptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilk
algpaatleemmtacqgvggpghkarvl

SCOPe Domain Coordinates for d2koda_:

Click to download the PDB-style file with coordinates for d2koda_.
(The format of our PDB-style files is described here.)

Timeline for d2koda_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2kodb_