SCOPe 2.08: Domain d2ko7a1: 2ko7 A:5-117

Lineage for d2ko7a1 (2ko7 A:5-117)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (29 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:272560] [226139] (3 PDB entries)

8. Domain d2ko7a1: 2ko7 A:5-117 [242590]
   Other proteins in same PDB: d2ko7a2
   automated match to d2y78a_
   complexed with jzf

Details for d2ko7a1

PDB Entry: 2ko7

PDB Description: Solution structure of peptidyl-prolyl cis-trans isomerase from Burkholderia pseudomallei complexed with Cycloheximide-N-ethylethanoate

PDB Compounds: (A:) peptidyl-prolyl cis-trans isomerase

SCOPe Domain Sequences for d2ko7a1:

Sequence; same for both SEQRES and ATOM records:

>d2ko7a1 d.26.1.0 (A:5-117) automated matches {Burkholderia pseudomallei [TaxId: 272560]}
mtvvttesglkyedltegsgaearagqtvsvhytgwltdgqkfdsskdrndpfafvlggg
mvikgwdegvqgmkvggvrrltippqlgygargaggvippnatlvfevelldv

Timeline for d2ko7a1:

• d2ko7a1 first appeared in SCOPe 2.04, called d2ko7a_
  
• d2ko7a1 appears in SCOPe 2.07