Lineage for d2ko3a_ (2ko3 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2538336Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2538554Protein Nedd8 [54244] (1 species)
  7. 2538555Species Human (Homo sapiens) [TaxId:9606] [54245] (16 PDB entries)
    Uniprot Q15843
  8. 2538594Domain d2ko3a_: 2ko3 A: [242589]
    automated match to d2bkrb_

Details for d2ko3a_

PDB Entry: 2ko3 (more details)

PDB Description: nedd8 solution structure
PDB Compounds: (A:) nedd8

SCOPe Domain Sequences for d2ko3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ko3a_ d.15.1.1 (A:) Nedd8 {Human (Homo sapiens) [TaxId: 9606]}
mlikvktltgkeieidieptdkverikerveekegippqqqrliysgkqmndektaadyk
ilggsvlhlvlalrgg

SCOPe Domain Coordinates for d2ko3a_:

Click to download the PDB-style file with coordinates for d2ko3a_.
(The format of our PDB-style files is described here.)

Timeline for d2ko3a_: