Lineage for d2knza_ (2knz A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1723911Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1723935Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1723936Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1724030Protein automated matches [190533] (3 species)
    not a true protein
  7. 1724064Species Mouse (Mus musculus) [TaxId:10090] [190002] (3 PDB entries)
  8. 1724067Domain d2knza_: 2knz A: [242588]
    automated match to d2dnaa1

Details for d2knza_

PDB Entry: 2knz (more details)

PDB Description: nmr structure of cip75 uba domain
PDB Compounds: (A:) Ubiquilin-4

SCOPe Domain Sequences for d2knza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2knza_ a.5.2.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gplgsmpevrfqqqleqlnsmgfinreanlqaliatggdinaaierllgsqls

SCOPe Domain Coordinates for d2knza_:

Click to download the PDB-style file with coordinates for d2knza_.
(The format of our PDB-style files is described here.)

Timeline for d2knza_: