SCOPe 2.06: Domain d2knvb1: 2knv B:3-52

Lineage for d2knvb1 (2knv B:3-52)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
   3 helices; bundle, right-handed twist

4. Superfamily a.5.2: UBA-like [46934] (5 families)

5. Family a.5.2.1: UBA domain [46935] (25 proteins)

6. Protein Sequestosome 1 (Sqstm1) [101063] (1 species)
   ubiquitin-binding protein p62

7. Species Human (Homo sapiens) [TaxId:9606] [101064] (5 PDB entries)

8. Domain d2knvb1: 2knv B:3-52 [242587]
   Other proteins in same PDB: d2knva2, d2knvb2
   automated match to d1q02a_

Details for d2knvb1

PDB Entry: 2knv

PDB Description: nmr dimer structure of the uba domain of p62 (sqstm1)

PDB Compounds: (B:) Sequestosome-1

SCOPe Domain Sequences for d2knvb1:

Sequence; same for both SEQRES and ATOM records:

>d2knvb1 a.5.2.1 (B:3-52) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]}
ppeadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh

Timeline for d2knvb1:

• d2knvb1 first appeared in SCOPe 2.04, called d2knvb_
  
• d2knvb1 was called d2knvb_ in SCOPe 2.05
  
• d2knvb1 appears in SCOPe 2.07
  
• d2knvb1 appears in the current release, SCOPe 2.08