Lineage for d2knva1 (2knv A:3-52)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696009Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 2696033Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 2696034Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 2696074Protein Sequestosome 1 (Sqstm1) [101063] (1 species)
    ubiquitin-binding protein p62
  7. 2696075Species Human (Homo sapiens) [TaxId:9606] [101064] (5 PDB entries)
  8. 2696076Domain d2knva1: 2knv A:3-52 [242586]
    Other proteins in same PDB: d2knva2, d2knvb2
    automated match to d1q02a_

Details for d2knva1

PDB Entry: 2knv (more details)

PDB Description: nmr dimer structure of the uba domain of p62 (sqstm1)
PDB Compounds: (A:) Sequestosome-1

SCOPe Domain Sequences for d2knva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2knva1 a.5.2.1 (A:3-52) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]}
ppeadprlieslsqmlsmgfsdeggwltrllqtknydigaaldtiqyskh

SCOPe Domain Coordinates for d2knva1:

Click to download the PDB-style file with coordinates for d2knva1.
(The format of our PDB-style files is described here.)

Timeline for d2knva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2knva2