Lineage for d2knfa1 (2knf A:-1-82)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3033267Fold g.14: Kringle-like [57439] (1 superfamily)
    disulfide-rich fold; nearly all-beta
  4. 3033268Superfamily g.14.1: Kringle-like [57440] (3 families) (S)
  5. 3033269Family g.14.1.1: Kringle modules [57441] (7 proteins)
  6. 3033340Protein Plasminogen [63400] (1 species)
  7. 3033341Species Human (Homo sapiens) [TaxId:9606] [63401] (20 PDB entries)
  8. 3033371Domain d2knfa1: 2knf A:-1-82 [242581]
    Other proteins in same PDB: d2knfa2
    automated match to d1b2ia_

Details for d2knfa1

PDB Entry: 2knf (more details)

PDB Description: solution structure and functional characterization of human plasminogen kringle 5
PDB Compounds: (A:) plasminogen

SCOPe Domain Sequences for d2knfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2knfa1 g.14.1.1 (A:-1-82) Plasminogen {Human (Homo sapiens) [TaxId: 9606]}
dcmfgngkgyrgkrvttvtgtpcqdwaaqephrhsiftpetnpragleknycrnpdgdvg
gpwcyttnprklydycdvpqcaa

SCOPe Domain Coordinates for d2knfa1:

Click to download the PDB-style file with coordinates for d2knfa1.
(The format of our PDB-style files is described here.)

Timeline for d2knfa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2knfa2