SCOPe 2.06: Domain d2knbb_: 2knb B:

Lineage for d2knbb_ (2knb B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (10 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [189104] (4 PDB entries)

8. Domain d2knbb_: 2knb B: [242579]
   Other proteins in same PDB: d2knba_
   automated match to d3iqlb_

Details for d2knbb_

PDB Entry: 2knb

PDB Description: Solution NMR structure of the parkin Ubl domain in complex with the endophilin-A1 SH3 domain

PDB Compounds: (B:) Endophilin-A1

SCOPe Domain Sequences for d2knbb_:

Sequence; same for both SEQRES and ATOM records:

>d2knbb_ b.34.2.0 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dqpccralydfepenegelgfkegdiitltnqidenwyegmlhgqsgffpinyveilval
ph

Timeline for d2knbb_:

• d2knbb_ first appeared in SCOPe 2.04
  
• d2knbb_ appears in SCOPe 2.05
  
• d2knbb_ appears in SCOPe 2.07
  
• d2knbb_ appears in the current release, SCOPe 2.08